NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214544_1010262

Scaffold Ga0214544_1010262


Overview

Basic Information
Taxon OID3300021320 Open in IMG/M
Scaffold IDGa0214544_1010262 Open in IMG/M
Source Dataset NameRoot nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13915
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.06Long. (o)-118.44Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046862Metagenome150Y
F046864Metagenome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0214544_10102621F046862GGAVRGGNDGTKGIEGRTTQEDIVGCWRVDDKEADWDGFSLGPLPKDGVEVDVATGGYLFTRKAIDWLVIWDHGSVRKLKFLVGGPVEDINGAALINEDFLNNVVFYFNSDNHRVILLMVEAVKVVICEDDRRHTASVVEMDDMIDGLDMAEVTFSGRRSGSSISEATRDGVNGVT
Ga0214544_10102623F046864AGGVGLYSLSSSVGWKAGDLAALKVSLAFPFRSGSASIFRLRREFSCRSASISSALHFFRSASSCCIFAWPSRMAARSGVMLAGPEGPASACLFTPALLRVETIFREKRVLKVFVSYPTVGANCSCREQIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.