Scaffold Ga0214544_1002962

Overview

Basic Information

• Taxon OID: 3300021320
• Scaffold ID: Ga0214544_1002962
• Source Dataset Name: Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35476
• Total Scaffold Genes: 31
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (38.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.06
  • Long. (^o): -118.44

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029345	Metagenome	188	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214544_100296231	F029345	AGGA	MTQMRQINDLEKSLKVAEKRLQLVIQFTCVVIVLFVLLLCVIF