Scaffold Ga0210309_1116824

Overview

Basic Information

• Taxon OID: 3300021317
• Scaffold ID: Ga0210309_1116824
• Source Dataset Name: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1468
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 46.295
  • Long. (^o): -124.183
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063592	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210309_11168245	F063592	AGGAGG	MAKCYWVVMFDRDGGEKDPDGPYDCEEDAVGNAEGQLMDWQWVTYEIQDGDE