Basic Information | |
---|---|
Taxon OID | 3300021317 Open in IMG/M |
Scaffold ID | Ga0210309_1064567 Open in IMG/M |
Source Dataset Name | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 687 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 46.295 | Long. (o) | -124.183 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000254 | Metagenome / Metatranscriptome | 1450 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210309_10645671 | F000254 | N/A | ETPRSPSATSTSVKMGKGKGQAAVQFDLATALTKKEGRLIRKAEYMIPYHMARCPAYGWKESEEYFKAEELKEKIAAIEGKAKKRWEANFC |
⦗Top⦘ |