Scaffold Ga0210296_1005167

Overview

Basic Information

• Taxon OID: 3300021305
• Scaffold ID: Ga0210296_1005167
• Source Dataset Name: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3174
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.099
  • Long. (^o): -124.365
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056533	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210296_10051672	F056533	N/A	MASDYTDLKKYIKSMQEYYSSRGKSPYKVAPHVYKEAGIYSIQDLLEHRINNPWSRVDL