| Basic Information | |
|---|---|
| Taxon OID | 3300021300 Open in IMG/M |
| Scaffold ID | Ga0214523_1028889 Open in IMG/M |
| Source Dataset Name | Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 3, Penicillin and Streptomycin |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1364 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Piromyces → unclassified Piromyces → Piromyces sp. E2 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.4149 | Long. (o) | -119.841 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046107 | Metagenome / Metatranscriptome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214523_10288892 | F046107 | N/A | KAQKNTMYFGKLYYAGIFPFLTNKKEIKPRSNIFKIDNVVSTKLSPDSSFIELLGRDSPFVEIGEEPVLLLCLISTTSTLLVKFGILQYLSNNSLKRTT |
| ⦗Top⦘ |