Basic Information | |
---|---|
Taxon OID | 3300021297 Open in IMG/M |
Scaffold ID | Ga0210369_1047042 Open in IMG/M |
Source Dataset Name | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 539 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 46.313 | Long. (o) | -123.997 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006508 | Metagenome / Metatranscriptome | 371 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210369_10470422 | F006508 | GAGG | VALANAPSKAVAVQCQTVKTRKRNRRRVLTWFASRWRNHQPKRAEK |
⦗Top⦘ |