Basic Information | |
---|---|
Taxon OID | 3300021289 Open in IMG/M |
Scaffold ID | Ga0213903_110687 Open in IMG/M |
Source Dataset Name | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Cave_3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 536 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: West Virginia | |||||||
Coordinates | Lat. (o) | 38.083 | Long. (o) | -81.98 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068102 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213903_1106871 | F068102 | N/A | GCSKPEPLTEEKAKEIVASWMFKREPVYAEVPQRVWWNPKAPKDDYDEKAVRTLRNLERAGLVTVTEKLTADSGEYVAKVTKKGFPILGTAPSNRGPVYRATICQKVYDGLRNFVRHPHEPTVGHAELVWHYDNPTWLYPLFETKIDKPLKAPYLSNVSFWYAKHQWRFEINVKKTKA |
⦗Top⦘ |