Scaffold Ga0210338_180267

Overview

Basic Information

• Taxon OID: 3300021287
• Scaffold ID: Ga0210338_180267
• Source Dataset Name: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.380 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 796
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 46.27
  • Long. (^o): -123.946
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045132	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210338_1802671	F045132	GAG	VLMHSSNHYPLGNCDSPGSETNPDYLTQFGTVSHRSSLPSSFFACTDGARTPPEELVNSASSVAYVSTRLHRGRVNQPDPTFPRSPGRILETAADLFSLTVSRLCS