| Basic Information | |
|---|---|
| Taxon OID | 3300021282 Open in IMG/M |
| Scaffold ID | Ga0210303_1007072 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11776 |
| Total Scaffold Genes | 24 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 46.195 | Long. (o) | -123.822 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026012 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210303_10070721 | F026012 | N/A | KNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK |
| ⦗Top⦘ |