Scaffold Ga0213899_102953

Overview

Basic Information

• Taxon OID: 3300021272
• Scaffold ID: Ga0213899_102953
• Source Dataset Name: Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 645
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 8X (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States

Source Dataset Sampling Location

• Location Name: USA: West Virginia
• Coordinates
  • Lat. (^o): 39.458
  • Long. (^o): -79.073
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041962	Metagenome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213899_1029531	F041962	N/A	MSSNFLAPTSSELERDWGIVLGDDWATDVVGGDYAPIIRRFGLGAAAQREAVLARFGLIPSTAKTARSPGSTVNARSETAA