| Basic Information | |
|---|---|
| Taxon OID | 3300021272 Open in IMG/M |
| Scaffold ID | Ga0213899_100592 Open in IMG/M |
| Source Dataset Name | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1009 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.458 | Long. (o) | -79.073 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070593 | Metagenome / Metatranscriptome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213899_1005922 | F070593 | AGGAG | MEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDSKKGKKENKKQP |
| ⦗Top⦘ |