| Basic Information | |
|---|---|
| Taxon OID | 3300021260 Open in IMG/M |
| Scaffold ID | Ga0213898_100363 Open in IMG/M |
| Source Dataset Name | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1030 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.458 | Long. (o) | -79.073 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025377 | Metagenome | 202 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213898_1003632 | F025377 | GAG | MRVYWKWVIRSVPSLVLGVLMLLSTVTPRQARSNVEAWLNYFGIEEVPLWLANQYTDTWVFWLAFVGFCAWAIHLYVRTNVRNGKLSIILREGEPWVQVNSGADRSQAARTGGPLYTYRVALVNSDDSTIRNVEVKLI |
| ⦗Top⦘ |