Scaffold Ga0210345_150156

Overview

Basic Information

• Taxon OID: 3300021258
• Scaffold ID: Ga0210345_150156
• Source Dataset Name: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 591
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.178
  • Long. (^o): -123.853
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075465	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210345_1501561	F075465	N/A	RGQAYSLILGQCTQLLQDKMKQDADWTTVSTSYDPLTLFRLIEKTVLAQTEDQYPFATVYDQEHAFYSFRQETLTNPQWYEKFNTRIDVAEAIGVTRNHKALLEYVAKDVHKKKFADLGAAIQEAVRVDAEERYRAYVFLRQSGAQHANLRTVLQNDFTTGDDHYPKNRQSALHLLDKFSKTTVSKATTQSEGTAF