NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210406_10000062

Scaffold Ga0210406_10000062


Overview

Basic Information
Taxon OID3300021168 Open in IMG/M
Scaffold IDGa0210406_10000062 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)169819
Total Scaffold Genes155 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)123 (79.35%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000678Metagenome / Metatranscriptome940Y
F004377Metagenome / Metatranscriptome441Y
F045397Metagenome / Metatranscriptome153Y
F103195Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0210406_10000062125F004377AGGMASVNEGTIRVHRSIGGTGAAFRVAFVPYAEGDDSKPAGERAFNHLQEVRAFLKVLGVGAEYIKDVLRQLTMGRSAWVPNVSISEKVLRNAGFVSIGNLARSN
Ga0210406_1000006225F000678GAGGMSRFEEFGKRIDEEVSKLRSIDSFEDFGKQVDEKLAAVKQFVSEDVAPETEKRTAQFLREVSEKLTEAAGWLEARNADRTSKTPKNEAS
Ga0210406_1000006252F103195GAGGMLGTSDNEEASDRACQGVSAREPACNLAATVHCIQCDLWFCDIHAEDEQWHACMKAAN
Ga0210406_1000006260F045397GGAGGMLHATRFKILAAIFLLSSIAAIFFARNSGAQEGKPPALPLPEMQKLSRLYAGTWTYTETYPKSPMFPNGGENTGFYTSELGPGGNSIFNHFHSKGPVGEFDGTIVMTWDPKEKLYKAYVFGDSFPSAVVETGQWENDALVYRFELAMGPTKIALRNVTKFLPDGKLTSEEFTSVNGAAETLFVHVAAVKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.