Basic Information | |
---|---|
Taxon OID | 3300021142 Open in IMG/M |
Scaffold ID | Ga0214192_1184532 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 510 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021714 | Metagenome / Metatranscriptome | 217 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214192_11845321 | F021714 | N/A | SLPAPPSQKKKPDSKAKFGKRNIKNNPATLGEKKVKLPPTSFRRPGLILPKQCRKNCPETSFGLNCIHSTTMSYQDFAHTTKFLTPGTISIEAIRKAQKADSFTLNLLKNKSKQFVKIDDVLFHSSPNRNENRLVLPNNLIDALIVSKHITVFGLHHSKTRMRREIASR |
⦗Top⦘ |