Scaffold Ga0214247_1078434

Overview

Basic Information

• Taxon OID: 3300021135
• Scaffold ID: Ga0214247_1078434
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026565	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214247_10784341	F026565	N/A	IMAMFSQNTITQVSGFDNPCIAGELVWEQQTYWNLDIVGSDGVTPLDLTSATIDAQIIRRTVTNLQDSRYGLSFDIGDYSPTPTPISLTITNEVAAQGKFTLVINDSTWGLMADDPELDIGAQDCVAYSGRIKISFPASGSNPANDYIIFLLFLIRSDGIVVE