Scaffold Ga0214199_1006339

Overview

Basic Information

• Taxon OID: 3300021124
• Scaffold ID: Ga0214199_1006339
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1533
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. BK022 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057071	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214199_10063391	F057071	N/A	AFSTWAATGFQHDLAHLGYILVGFITGGLVSHNPNVSPDSHIQTPYQPNMDDGGSTLKPIVIPQDPYKPEGTDVKRVIQINSGIVK