Basic Information | |
---|---|
Taxon OID | 3300021068 Open in IMG/M |
Scaffold ID | Ga0206684_1175840 Open in IMG/M |
Source Dataset Name | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 699 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 36.6907 | Long. (o) | -122.3448 | Alt. (m) | Depth (m) | 100 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057669 | Metagenome / Metatranscriptome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206684_11758401 | F057669 | GAG | MTSIIPSEHWNGFTFEFSNGWSVSIQQSESHYSTVGKTAEVAIFDPKENWYAYDEEDGVVNELPNADTYVNGHLDADAIAKIISIISQEKVDIRTSK |
⦗Top⦘ |