NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206684_1070500

Scaffold Ga0206684_1070500


Overview

Basic Information
Taxon OID3300021068 Open in IMG/M
Scaffold IDGa0206684_1070500 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1202
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060984Metagenome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0206684_10705002F060984N/AMTMETYAERLQKEKEKPMTNYDMDEIERERDRNSFASVKIGESKSKEATTEVEIELSHDDLLILTLAAHDRDITLNQLCNSVLKDSLKDLEYRFEHQTKPQVLKEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.