| Basic Information | |
|---|---|
| Taxon OID | 3300021051 Open in IMG/M |
| Scaffold ID | Ga0206224_1001708 Open in IMG/M |
| Source Dataset Name | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2164 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Colorado | |||||||
| Coordinates | Lat. (o) | 38.96 | Long. (o) | -106.99 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007886 | Metagenome / Metatranscriptome | 343 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0206224_10017081 | F007886 | AGGA | LNLELGSSLVPAVYLVVDDDGVVGAVLEVLEVVLGGVLAGADAGGEAGVEGVADVVWSDVLGAASFFSSVVGAGASLPAEGFILSE |
| ⦗Top⦘ |