| Basic Information | |
|---|---|
| Taxon OID | 3300021047 Open in IMG/M |
| Scaffold ID | Ga0210242_100118 Open in IMG/M |
| Source Dataset Name | Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States - P5a_16mM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 59576 |
| Total Scaffold Genes | 31 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (51.61%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington | |||||||
| Coordinates | Lat. (o) | 47.6519 | Long. (o) | -122.3113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008934 | Metagenome / Metatranscriptome | 325 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210242_10011815 | F008934 | N/A | MSSLAHLDKDGDGDIDSSEWAAGYAQLGASAPGVPNPAVWYGTLPDGPAFRITQIGMDKLYSAPSQLIDHPEYKDETGKGVIVGYAGHVPRARDKVGGSPLGHLPGTPVSPNGKVGIDMEAMMSGKFKRELPAGREKTFAQHECKPDYTPEARDKGVAGTQKPALYGEGIIPGYGGHKQGAKFNYGSTIYTNGRPKGGSAHDNYGGRNLASTGHGADSLASGDYNYKDGRIADAWIDDHGMGGKTEVWRRDAQGFKDGEKYIEFGEMAHVQVGKNRNH |
| ⦗Top⦘ |