NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0215015_10917531

Scaffold Ga0215015_10917531


Overview

Basic Information
Taxon OID3300021046 Open in IMG/M
Scaffold IDGa0215015_10917531 Open in IMG/M
Source Dataset NameSoil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Colorado
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1881
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us

Source Dataset Sampling Location
Location NameHuntingdon County, Pennsylvania, United States
CoordinatesLat. (o)40.6949Long. (o)-77.9199Alt. (m)Depth (m).9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001720Metagenome / Metatranscriptome647Y

Sequences

Protein IDFamilyRBSSequence
Ga0215015_109175312F001720N/ASGIYDTVKRVARAAFPQTQQGNVDMIEAVAQQKLGMPSAEAIGLLTGEIATLQTSPSMDTAKQVYFFGIRRKPETLKLLRTIAGEQLSSERNEGDVTFLELSLGGKQGAAGSAQWKFFHLAVTPDLIIGASRVETLQEFLATRAKGPASGGLAAVPQFQANRAKYPENLISLSYLDFKKIDWQGMKDRWIEEAKKSAAVKTVSTSKEPTPSAGADWLAQINPQVFARHLHYSSSVSWKDTKGIHWDQWIE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.