Scaffold Ga0215015_10017886

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0215015_10017886

Scaffold Ga0215015_10017886

Overview

Basic Information
Taxon OID	3300021046 Open in IMG/M
Scaffold ID	Ga0215015_10017886 Open in IMG/M
Source Dataset Name	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17805
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (77.78%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us

Source Dataset Sampling Location
Location Name	Huntingdon County, Pennsylvania, United States
Coordinates	Lat. (^o)	40.6949	Long. (^o)	-77.9199	Alt. (m)		Depth (m)	.9
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075111	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215015_1001788611	F075111	AGGAG	MRKGKKALLIAAAMILTIATLAVLSFVRSKMQTNEPSANPAARIVVSGIRVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.