| Basic Information | |
|---|---|
| Taxon OID | 3300020818 Open in IMG/M |
| Scaffold ID | Ga0214277_11580888 Open in IMG/M |
| Source Dataset Name | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1141 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006329 | Metagenome / Metatranscriptome | 376 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214277_115808881 | F006329 | AGGAGG | MILELHVANVVHNHKIKMDAMRLKISKIRKYAIHTEAWYHYAVGSIVTLVAITIAFVFALKCFT |
| ⦗Top⦘ |