NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214277_11051850

Scaffold Ga0214277_11051850


Overview

Basic Information
Taxon OID3300020818 Open in IMG/M
Scaffold IDGa0214277_11051850 Open in IMG/M
Source Dataset NameFood waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046965Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0214277_110518501F046965N/ALRLEIENEKLIAKAKDLNVCNISISNLRDENAILHAKVDELNACKPSTSTVSHVSICTRCKDVNVDAIHDHIAMIKQQNDHIAKLDAKIVEHELENKKFKFARSMLYSGRRPGIKDGIGFQKGDNVKLNAPPKRLSNFVKGKAPMPQDNEGYILYPAGYPESKIRRIHS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.