Scaffold Ga0214277_10348125

Overview

Basic Information

• Taxon OID: 3300020818
• Scaffold ID: Ga0214277_10348125
• Source Dataset Name: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105149	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214277_103481252	F105149	GAGG	MFRKMYQGGPSRKQGPRLAMRDAEPCEWPSEDFMDRAGIKEEFNAYLRNADLVSFEAEKCRQYHYLTSSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFNTGCKLPQWGSPDEPRKSEFRVFLASITVGESRDITQATIG