Scaffold Ga0214172_1032550

Overview

Basic Information

• Taxon OID: 3300020733
• Scaffold ID: Ga0214172_1032550
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 784
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056262	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214172_10325503	F056262	GGA	VDGYQSMTVVAGLVTPEGAWIGADSLSSTDDGLASLIATPKVGRFGNLLLGYSGSFKVGAMYFKVAGRSHNPTLEQLLESVKLPDDLKD