Scaffold Ga0214251_1015864

Overview

Basic Information

• Taxon OID: 3300020729
• Scaffold ID: Ga0214251_1015864
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1398
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071947	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214251_10158642	F071947	GGA	VQGTGPNLSGSVKLDLDLLKPWRVSAAAAATNDDASPPVRHMSQQQPSQVWLEYAYRKHHPALQWLPTKLAEWIANNLQDELGFPDKADPRRGWTPAELNSILQNHVVRNRAGCALTTFGCVEWESELYRGVMRARCYPWNMPKHRFHKMNPQVIPCYPWLYTYIT