NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214252_1006592

Scaffold Ga0214252_1006592


Overview

Basic Information
Taxon OID3300020720 Open in IMG/M
Scaffold IDGa0214252_1006592 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1929
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038566Metagenome / Metatranscriptome165Y
F048775Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0214252_10065921F048775N/ASGASATAVVGTGATASISGIYTNGKRMRFPLNNALNDLKLSVNARCVVEMCNIPSITNMAGKYVIVRLVTSTQDKTCDTKKFLNGNPILLSMAAQSNVGSTNLLYNASEFFYNINVPTTLFSNGYIDLELEVPSATANIDFITSKPLSTFFLNLIIVDEDPQITKDLTLAPPIDYKNYNVNMPIRPY
Ga0214252_10065922F038566N/AMSKINIYVNSKNRKSDESPSNFSVIIPDGLLKCDANEYFSLSVNSFYCYNDFYQCNINSNSFKIIFRTNLNVVYLTTNYNLNIGNPNVYDLMTDINSKLSGYLTCTYNEIKNKITYTRTYAQTTNYYNMNIYCVNSGSFFGLTNNVETLILTTGTESMYPININTIKALSIGIDGDISFNYNNMESNLTNSLYKASDLIFQMGLNVPRGYLLDYQNVDGGDSFCFNLGNKDRIKYFILSVYDQDGNTISDMTDYIIHMQFTINKKSQTELLLKSLIDYNKQIYLIVGHIFDLIYKYLNHN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.