Scaffold Ga0180218_1012030

Overview

Basic Information

• Taxon OID: 3300020598
• Scaffold ID: Ga0180218_1012030
• Source Dataset Name: Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft BY (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2975
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090842	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180218_10120303	F090842	GGAG	MLKRFFGSSEEPLIPVCPDHDVEMRLRGKMGKPTRFSDQSASEYTLIYFCPVPGCNNTATRERQRLQIPAPGVAPERPIFSRLDDGR