NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206126_10003753

Scaffold Ga0206126_10003753


Overview

Basic Information
Taxon OID3300020595 Open in IMG/M
Scaffold IDGa0206126_10003753 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15185
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y
F031650Metagenome / Metatranscriptome182Y
F064103Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0206126_1000375310F017048N/AMTDYNYQPSKSSLRADTIVSMCSRSLLDFKMSEIPGMGPASIDKFKDHGIYTPAQIVAKFLSFVDSADVSAHDVCEGFYNWANPIMGKANTHNLTFALANYAGEHGLFNFE
Ga0206126_1000375312F031650GGAMSNMSEEEFNQLKLEYTNAIPEGDAIKAQLKSHNKEQKERLNNIHSYMRENNLMSADLGGITFEREEKTTVPSVSVKTLEEIVDNPAVVEQYKRDYAKTKESLRVRKPKRQRTSTSDE
Ga0206126_1000375318F064103N/AMLKWILGLFFFIGIVLQVRNFNRYHVERKRKHNEAQVYLDSDVCTDAVTRSQLGTFNLCEKADHILNESPLEAAAYDILNDWYPCGHGRCDGTLDWLASNAHWFVMIIVMVGMMIYYKWVDHQRDILFTRMSLPQLIKNKIEHVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.