Basic Information | |
---|---|
Taxon OID | 3300020591 Open in IMG/M |
Scaffold ID | Ga0180223_1004966 Open in IMG/M |
Source Dataset Name | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft OP (version 2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5971 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Emeryville, California | |||||||
Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030808 | Metagenome / Metatranscriptome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180223_10049661 | F030808 | GGGGG | MLNLNLSAFQSQEFIVGIAVAAILVSALAASSMFRNIALALAAGGVVLLYLQGGVPALLATSAMVEKEIRSLPDFSNGLIVGLAVSAVFMLGMQKRSA |
⦗Top⦘ |