NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213496_10086969

Scaffold Ga0213496_10086969


Overview

Basic Information
Taxon OID3300020590 Open in IMG/M
Scaffold IDGa0213496_10086969 Open in IMG/M
Source Dataset NameLeaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.6622Long. (o)-119.6197Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011735Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0213496_100869691F011735N/APFIVKRVLEKGAYELVDFEGNKLTEPQNGLYLKKYFA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.