Basic Information | |
---|---|
Taxon OID | 3300020590 Open in IMG/M |
Scaffold ID | Ga0213496_10072626 Open in IMG/M |
Source Dataset Name | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 537 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Convolvulaceae → Cuscuteae → Cuscuta → Cuscuta subgen. Grammica → Cuscuta sect. Cleistogrammica → Cuscuta campestris | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.6622 | Long. (o) | -119.6197 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023843 | Metagenome / Metatranscriptome | 208 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213496_100726261 | F023843 | GGTGG | MTSSGKIEFKKFNGHSFELWKLKMEDLLVDIDQWIVVDLGTKPMGVSDEKWNKLDRKAKSII |
⦗Top⦘ |