| Basic Information | |
|---|---|
| Taxon OID | 3300020588 Open in IMG/M |
| Scaffold ID | Ga0213495_10088821 Open in IMG/M |
| Source Dataset Name | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.6622 | Long. (o) | -119.6197 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057039 | Metagenome / Metatranscriptome | 136 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213495_100888211 | F057039 | GAG | VDGVVVVVEVNGKGNMEFGMEDIEENTEDIEDIVDGFHKFLSNLVAKIGFGVVMVNVAKIGFGVVMATVAKEKVCSNYL |
| ⦗Top⦘ |