NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210395_10000037

Scaffold Ga0210395_10000037


Overview

Basic Information
Taxon OID3300020582 Open in IMG/M
Scaffold IDGa0210395_10000037 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)149931
Total Scaffold Genes113 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)93 (82.30%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000532Metagenome / Metatranscriptome1046Y
F016077Metagenome / Metatranscriptome250Y
F022062Metagenome / Metatranscriptome216Y
F062026Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0210395_10000037107F062026AGAAGGMDLSCPKCKSEDTQKLTMVMSASGLFGKILRFGSVYVYNVWIPVASVFFGIAFGIAFGLFNGYLGFFAFTGTLVAGFFARKWVKAKTRSKFADLSDNMKQNGFQCKRCEHLFIPVESLPAPKMQIASA
Ga0210395_1000003718F022062AGGAMDIHRRTAPRTSHDLLPNPTEVIPFGRYGAGLWTGHPIGLVIVVGLLLMGFVGLPEVRLFLELTVPLGCVCGFFLWLHHR
Ga0210395_1000003770F016077AGGAMSTAPATAASPHEGTSARFRNLLVGTLFAVVLLIPKLLRIRRNARSWMVFRVFLGFAGAALVVLPLGLWNSWLAAIAGLGMFMAAILLPPAKSHSVSDDKARELGALVIVNGGKYQPGNAAPAPVQLFVGAERIWALDAHLQPLLVIPAPEITSAKAVQYKDRWILEVRWLDNAAEFSYQGIFAEHLAHVAQSTLGSVMRSPLPILPRSRAASA
Ga0210395_1000003791F000532AGGVNLIKNRLNMDVVLTPGKTGQFDVVADGEKIAERGGNWLTRSFGAGYPELDSVVEKLEKHRKNKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.