| Basic Information | |
|---|---|
| Taxon OID | 3300020578 Open in IMG/M |
| Scaffold ID | Ga0194129_10170105 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1367 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tanzania: Lake Tanganyika | |||||||
| Coordinates | Lat. (o) | -4.9054 | Long. (o) | 29.4853 | Alt. (m) | Depth (m) | 35 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016159 | Metagenome / Metatranscriptome | 249 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0194129_101701052 | F016159 | N/A | VCEACRPQPQNKEAYGKGYYSDKIAQMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFTFMLGPKFTVFYNVYTRYETQQLCAQWADVVEEHQMLHLQHSKEQMEYVRINKEFDFVKKRAMVNFLTNSRAELEHHFHNRAQNMLHSIERYEQNNLRHLLNGIGKGAVDKIHA |
| ⦗Top⦘ |