NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194129_10061088

Scaffold Ga0194129_10061088


Overview

Basic Information
Taxon OID3300020578 Open in IMG/M
Scaffold IDGa0194129_10061088 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2776
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.9054Long. (o)29.4853Alt. (m)Depth (m)35
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F025979Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0194129_100610881F000258GGTGGVTVNYKLDAMLELRKYLWKELYTRKIFDKDDYWSDNLNENIVPIIPVQQVAEMNQFLSGKKHIVYDKIGLSYEENWLICCEQILFNIYATSVADIIEIRNYMTDEFRRMDDSARDINKWTDLSNKFKFHSIFIADISPTAPSEELQGF
Ga0194129_100610885F025979N/ADTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.