NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207909_1054691

Scaffold Ga0207909_1054691


Overview

Basic Information
Taxon OID3300020572 Open in IMG/M
Scaffold IDGa0207909_1054691 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)613
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064410Metagenome / Metatranscriptome128Y
F073057Metagenome120N

Sequences

Protein IDFamilyRBSSequence
Ga0207909_10546911F073057AGGMIVRMDTKAFDKQMNNIINYSFGFLDGVQKGKKVFLDKLGVGVIQALSQYVDVQARANPKALHHVYEWSQSGSPGSRLFDLNYTVSNLGLSLNSKFRQSRTVSENMTVPFYNKAKIMEDGIPVTIAPT
Ga0207909_10546912F064410N/APRLSSNNSYNAITNILITNIRTANDSVIYKETAGARSGRGTIYEVATVEPFTGPFGNIEYYKMLWRRTENQTVGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.