| Basic Information | |
|---|---|
| Taxon OID | 3300020572 Open in IMG/M |
| Scaffold ID | Ga0207909_1003367 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3765 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (60.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.098333 | Long. (o) | -89.405278 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002398 | Metagenome / Metatranscriptome | 563 | Y |
| F021296 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207909_100336710 | F021296 | AGGA | MSDTRTSFLELDDAPVKIQPNTSVFSNAGGFQVAEGSTAKQDANGNWVNAIGLQSTASHRHVSKIWQDKCTPLADFVNVVKGEAPNKKDITKKESEIRLLDANTLIDGTPLNESGLNSLRMFTDIPSTMLNFLKEREYNDEMVKFVNGELDRRETEWNGKGKDARSFLVRTRQDDEGNDIIRAIVSERYGVIDNAEAMEIIANSLPSLDDALASHIFNNGDDIFGNIL |
| Ga0207909_10033675 | F002398 | GGA | MIALISIFLLTSVDQIKNFVSLKTYISENAKAHCYVYFINEDIPDFPRVNVIEKSKFDFFAYLDTIGIEHSKVGSYYFFQRKPK |
| ⦗Top⦘ |