Basic Information | |
---|---|
Taxon OID | 3300020571 Open in IMG/M |
Scaffold ID | Ga0208723_1052233 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 562 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.098333 | Long. (o) | -89.405278 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035298 | Metagenome | 172 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208723_10522331 | F035298 | N/A | YALTWNQYILKCQGFFNKEKKDWERIGWSTWNGMRVHVNKGMPSFKKFMSFIYENDEIADMDIIKDQMNKAMLKYLQDARN |
⦗Top⦘ |