NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208718_1003725

Scaffold Ga0208718_1003725


Overview

Basic Information
Taxon OID3300020565 Open in IMG/M
Scaffold IDGa0208718_1003725 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3134
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066776Metagenome / Metatranscriptome126Y
F072349Metagenome / Metatranscriptome121Y
F105192Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0208718_10037255F105192N/AMNIPLTEILITLFAAAISGLLTAQIGARRYKKERIEHRAEKAHDQLLLELKDLEIKLYKLEKDLNEWKDKYFEALQELIRVKAELEGTLLKLSHIEMHSNED
Ga0208718_10037256F072349AGGAGGMDKVLCYSCNKSKNELSAKKSVLLPINLLLCKSCTDNKLEPRWIVILAGRQYGSDHVKEHIAKKKYVGLDITASELLI
Ga0208718_10037259F066776AGGLLHLTEKGVEIFIKRSRTKLQESFWNNYDLVIWKKDSGGYTDVKGMYRKDAWGKAEKISVSREGIWELPKRYVKYFK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.