NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208360_1009533

Scaffold Ga0208360_1009533


Overview

Basic Information
Taxon OID3300020551 Open in IMG/M
Scaffold IDGa0208360_1009533 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1403
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002260Metagenome / Metatranscriptome577Y
F041183Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0208360_10095331F041183N/ATAFDIFYGWTTSFQLAATLGGELGESFAEKVDQRVTAAFEDFKATPGNTFYPVSADGFTRVLELGAMELLSAGVPSNTAGWTTGFSASEVLELVRNIKQNFKVARMPGAPVIVLDSNGYVTEFASGAIGGSGSSLTRLLAELTGGAVASSGGSNLSALGNELLSTGKIESVYGCQIMFTTFLQSANRIMLGQGSASPVLVGAYFGDSALFTVMKEGLQLKSGETPGGLQMWLTGVGYFGSGVGDLRRGGAINILQD
Ga0208360_10095332F002260GGAMSVPYQRISNATVVDIAFYDPAAERRAAALDVDWEPYFKVGSQEMLYKMEFGWWQNYCDTVIGAYYYDNLPNGQLISSFNPSLLIKNDQTLIRLDCFAAILVFYESLVTDVSNMNEVDLQNFNFAKERAYNEWEKAQQLSNWYDLFQDAPQGPTTKLEENWTADPNYFNGDRRYF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.