NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208856_1002366

Scaffold Ga0208856_1002366


Overview

Basic Information
Taxon OID3300020548 Open in IMG/M
Scaffold IDGa0208856_1002366 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4910
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005320Metagenome / Metatranscriptome405Y
F074881Metagenome / Metatranscriptome119Y
F088893Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0208856_10023662F005320GGAGGMSIDTLKPVKVAGEIFWSNWMNTFNTKFNEDNKKYECTIGNLSDAACEKLKELGINIKNKEGMGNYIVAKSTYLFAPVDEGGDPVNIALMGNGTKCHAVISSYRHKMSAKFGAAPSIKKLIVTELKVYVPEGAEEEETADDVL
Ga0208856_10023663F074881GAGGMVFDVEPNEAAFIVRVIGQLPTESGAFPLHQKLVAQFQEQEKQSANEPTVTDVTAK
Ga0208856_10023664F088893AGGMSKNIDKNQILFNVEGDTFKVKIGEDLDLEEVYTVLASALVYLEDLAEGNVAHPFKELH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.