NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208364_1000992

Scaffold Ga0208364_1000992


Overview

Basic Information
Taxon OID3300020533 Open in IMG/M
Scaffold IDGa0208364_1000992 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5942
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020883Metagenome221Y
F064418Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0208364_100099213F020883GAGGMEASFMITQVETTLSNYTSYYKRLGMQDLAIWQTLEDIYKRPELHDLTLLSTREEAFDKIVKDNWFVDMGQHFYGLDYETIDELTLEYLKDNQLVKEIDND
Ga0208364_10009925F064418AGGAGMGKPRPTEIKLVAKLLDPDAENSEDAAELAVEIIEALDKSRTKRESFIVVAKLADWVPVQAWGEFSTRLQAEKFFPNLSSPDTGGKGSIVRLENPDDLLKRIGVTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.