NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208233_1000089

Scaffold Ga0208233_1000089


Overview

Basic Information
Taxon OID3300020529 Open in IMG/M
Scaffold IDGa0208233_1000089 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16045
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007029Metagenome / Metatranscriptome359Y
F023592Metagenome / Metatranscriptome209Y
F029049Metagenome / Metatranscriptome189Y
F030767Metagenome / Metatranscriptome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0208233_10000894F030767GAGGMAYKTKCRLCGKVTEHIERVVTDNLPPYVKSLQCVKCGVMGIVMMEDVKDAQ
Ga0208233_10000895F029049GAGGVVVCRVSSLVKVILDRAQEITAHRVGLERGVAFNSDPKDASNYGQTYTNYHELIWQHAEGCGAEMAVANYFGDYGFVPKTDNAHEEADVGANIEVKWTKHANGHLILQNRGEGRPNDVAVLVTGWSPVYVLLGWMPVHMAKQPKYKHPYQNNYWVPRSNLFEMQYLKRSNYGV
Ga0208233_10000896F007029AGGAGMGFLDNYEDVNARIKRFRAEFKSGRLVAYIESFDIEKGTILVRAEAYREYEDTVPSAVDYAFGNVATYPQNMRKWMVEDTITSAYGRCIGLLTPSLEHSSRPTVQDMEKVETLPASADPWSTKASIEDMATMASAVLEIGKELGGELVAAAPRCPHGTMIWAEGTAKATGKPWAAYKCTEKNRANQCNPYWHVLGSDGKWKPQV
Ga0208233_10000897F023592AGGMNSLDILIGLAACGMGFMFMVIGYSIGYKHGHGEGFVRGRAISQALKDKELI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.