NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208721_1000407

Scaffold Ga0208721_1000407


Overview

Basic Information
Taxon OID3300020518 Open in IMG/M
Scaffold IDGa0208721_1000407 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9524
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (56.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002540Metagenome / Metatranscriptome550Y
F015583Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0208721_100040715F015583AGGAGMKFVFALVVLFLPLAAQAQTVIVRGPAVISAQEHATIIARRGTLVHSSCGQTEGIGMGSTPEAARKNCCFFGKRVIVEEGVAYSPATRRWYAVIRYR
Ga0208721_10004074F002540AGGAGMSTPNYTATADEYAKYGNNLNVWEQLRLLSQWAPLLSYGQAFVNAVDPYKKSLVVADAAEWVASKTSAKVDDQLVRLLADILKTPQGEALVRWCLLKAEEAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.