Scaffold Ga0208697_1027708

Overview

Basic Information

• Taxon OID: 3300020507
• Scaffold ID: Ga0208697_1027708
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 649
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Lirvirus → Synechococcus virus SCBP3 → Synechococcus phage S-CBP3 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -89.404444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031066	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208697_10277082	F031066	GGA	VRVLVKSLFNELTDMATAHPFDPKVSSVTVQYVTPTADSRAFISAYGETAQTLTELSPKGVKVQAGGAAWPA