NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208084_1002965

Scaffold Ga0208084_1002965


Overview

Basic Information
Taxon OID3300020499 Open in IMG/M
Scaffold IDGa0208084_1002965 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2638
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000345Metagenome / Metatranscriptome1253Y
F032098Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0208084_10029653F000345GGAMTEPNEFGKALQEWWDSESCKQLQKESEEAKQRAVGKYFMLSESDKLDMVQAICHIMCKAEKEGTSHRGLMDELGIYPTGFWVDGLMEVHNALWSYYHDQKKEKELKDDLDALEKFTENKRDY
Ga0208084_10029659F032098N/APWYEFLAYCEICHQLNVPNQPSVGRFLAYRRYLKEVGVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.